PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 206aa    MW: 23688.5 Da    PI: 9.8846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0009genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++v+++G+g W++I++  g++R++k+c++rw +yl
      Gh_D11G0009  9 KGLWSAEEDSILMEYVRKHGKGKWNRIPKVTGLKRCGKSCRLRWINYL 56
                     678*******************************************97 PP

2Myb_DNA-binding568.9e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr++ +E +l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
      Gh_D11G0009  62 RGRFSDQENDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 107
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.595156IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-23359IPR009057Homeodomain-like
SuperFamilySSF466891.2E-307103IPR009057Homeodomain-like
SMARTSM007173.6E-14858IPR001005SANT/Myb domain
PfamPF002493.5E-16956IPR001005SANT/Myb domain
CDDcd001677.18E-121256No hitNo description
PROSITE profilePS5129425.74557111IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2560111IPR009057Homeodomain-like
SMARTSM007178.7E-1661109IPR001005SANT/Myb domain
PfamPF002496.3E-1662107IPR001005SANT/Myb domain
CDDcd001673.34E-1164107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEEKSEYKKG LWSAEEDSIL MEYVRKHGKG KWNRIPKVTG LKRCGKSCRL RWINYLSPGV  60
KRGRFSDQEN DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NHWNTHLSKK LGIIKNPTAH  120
SSQSQTPSKS SRDDDNSHSQ AQDQVMMTNT DALPSPRDYG NGSSSRFWQC HNNDHFNLHT  180
PTPVNVLDLL DHDHHVSLDF VWHGFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2791117108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38300.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738523110.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2443490.0GU244349.1 Gossypium arboreum MYB transcription factor (MYB) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488361.11e-150PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI03e-65WER_ARATH; Transcription factor WER
TrEMBLA0A0D2T6G01e-150A0A0D2T6G0_G
STRINGVIT_17s0000g08480.t011e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-64myb domain protein 66